Yahoo Web Search

Search results

1. Dictionary

   forward

   /ˈfɔːwəd/

   adverb

   • 1. in the direction that one is facing or travelling; towards the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or towards the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backwards as forwards"
   • 2. onward so as to make progress: "the signing of the treaty is a big step forward" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar towards the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. towards the future; ahead in time: "looking forward, earnings are expected to hit £7.2 billion" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to November"

   adjective

   • 1. directed or facing towards the front or the direction that one is facing or travelling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or towards the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. progressing towards a successful conclusion: "the decision is a forward step"
   • ▪ further advanced than expected or required: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or overfamiliar in manner: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in football, hockey, or other sports.
   • 2. agreements to trade specified assets, typically currency, at a specified price at a certain future date.

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavoursupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. dictionary.cambridge.org › dictionary › englishFORWARD | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   FORWARD definition: 1. towards the direction that is in front of you: 2. towards the goal or area that is defended by…. Learn more.

   • English (US)

     FORWARD meaning: 1. towards the direction that is in front...

   • Forward: Arabic Translation

     FORWARD translate: أمامي. Learn more in the Cambridge...

   • Znaczenie Forward, Definicja W Cambridge English Dictionary

     FORWARD definicja: 1. towards the direction that is in front...

   • A Step Forward

     A STEP FORWARD definition: 1. an improvement or development:...

   • Forward: Korean Translation

     forward translate: 앞으로. Learn more in the Cambridge...

   • Forward Market

     forward market definition: the buying and selling of...

   • Forward in Italian

     FORWARD translate: avanti, in avanti, avanti, in avanti, di...

   • Forward in Japanese

     FORWARD translate: 前方に, 前（まえ）へ, 前方（ぜんぽう）へ,...

3. www.merriam-webster.com › dictionary › forwardForward Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › forward

   • Cached

   Learn the various meanings and uses of the word forward as an adjective, adverb, verb, and noun. See synonyms, examples, word history, and related phrases of forward.

4. Videos

   • 

     0:29

     youtube.com

     Forward Meaning

     15 Apr 2015

     35.6K views

   • 

     3:11

     youtube.com

     Forward contract introduction | Finance & Capital Markets | Khan Academy

     18 Mar 2011

     444.7K views

   • 

     3:46

     youtube.com

     What is a Forward Contract?

     23 Jan 2019

     14.8K views

   View all

5. www.collinsdictionary.com › dictionary › englishFORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   forward applies to any movement toward what is or is conceived to be the front or a goal: to face forward; to move forward in the aisles. onward applies to any movement in continuance of a course: to march onward toward a goal.

6. dictionary.cambridge.org › learner-english › forwardFORWARD | definition in the Cambridge Learner’s Dictionary

   dictionary.cambridge.org › learner-english › forward

   • Cached

   Learn the meaning and usage of the word forward as an adverb, adjective, verb and noun in English. See translations of forward in different languages and examples of sentences with forward.

7. www.thefreedictionary.com › forwardForward - definition of forward by The Free Dictionary

   www.thefreedictionary.com › forward

   • Cached

   Learn the meaning, pronunciation, and examples of the word forward as an adjective, adverb, noun, and verb. Compare and contrast with foreword, forward-looking, and forward-thinking.

8. www.oed.com › dictionary › forward_adjforward, adj., n., & adv. meanings, etymology and more ...

   www.oed.com › dictionary › forward_adj

   • Cached

   Learn the meaning and history of the word forward, which can be an adjective, noun, or adverb. See examples of forward in different contexts, such as military, sports, and commerce.

9. www.dictionary.com › browse › forwardFORWARD Definition & Meaning - Dictionary.com

   www.dictionary.com › browse › forward

   • Cached

   directed toward a point in advance; moving ahead; onward: The chest-high snow made forward motion almost impossible. Antonyms: backward. being in a condition of advancement; well-advanced: It was quite forward in the season when we finished our planting. presumptuous, impertinent, or bold: That girl is a rude, forward child.