Yahoo Web Search

Search results

1. Dictionary

   chalky

   /ˈtʃɔːki/

   adjective

   • 1. consisting of or rich in chalk: "chalky soil"
   • 2. resembling chalk in texture or paleness of colour: "walls of chalky green" Similar palebloodlesspallidcolourlesswanashenwhitewaxenchalk whitemilkypastypasty-facedwhey-facedpeakysicklyanaemictired-lookingwashed outsallowdraineddrawnsappedghostlydeathlydeathlikeblanchedbleachedrare:etiolatedpowderyflourymealydustygrittycrumblyfriablegranulatedgranulargroundcrushedpulverizedrare:pulverulentlevigatedOpposite rosyflushedsmooth

   Derivatives

   • 1. chalkiness noun

   Scrabble Points: 18

   • C

     3

   • H

     4

   • A

     1

   • L

     1

   • K

     5

   • Y

     4

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. People also ask

   What does chalky mean?

   • Navvies, all white with that chalky whiteness of dried bones, were passing by, carrying their tools and wallets. Observe ye not yon chalky precipice, to the right of the Norman bridge? They abound on the chalky downs and in some sandy districts, but not in the clays. Chalky definition: of or like chalk. . See examples of CHALKY used in a sentence.

   CHALKY Definition & Meaning | Dictionary.com

   www.dictionary.com/browse/chalky

   See all results for this question

   What does chalk mean?

   • : a soft white, gray, or buff limestone made up mainly of the shells of tiny saltwater animals and especially foraminifers : chalk or material like chalk especially when used as a crayon : to rub, mark, write, or draw with chalk Old English cealc "chalk," from Latin calc-, calx "lime" — related to calcium

   Chalky Definition & Meaning - Merriam-Webster

   www.merriam-webster.com/dictionary/chalky

   See all results for this question

   What is a chalky colour?

   • 1. Something that is chalky contains chalk or is covered with chalk. [...] 2. Something that is chalky is a pale dull colour or has a powdery texture. [...] • bloodless, washed out, pale, wan [...] • dusty, powdery, fine, sandy [...]

   CHALKY - Find out everything about this English word | Collins

   www.collinsdictionary.com/dictionary/english-word/chalky

   See all results for this question

   When was chalky first used?

   • The earliest known use of the adjective chalky is in the Middle English period (1150—1500). OED's earliest evidence for chalky is from around 1400, in the Testament of Love. chalky is formed within English, by derivation. Etymons: chalk n., ‑y suffix1.

   chalky, adj. meanings, etymology and more - Oxford English Dictionary

   www.oed.com/dictionary/chalky_adj

   See all results for this question

   What does the nickname 'Chalky' mean?

   • Chalky is a nickname for various people and fictional characters. It includes Hollis Liverpool, a Trinidadian calypsonian and scholar, and the tyrannical teacher character created by cartoonist Carl Giles. The origin of the nickname is related to chalk used in teaching.

   Chalky - Wikipedia

   en.wikipedia.org/wiki/chalky

   See all results for this question

   What does a chalky ring on a cliff mean?

   • A chalky ring on the surrounding cliffs marked where the waterline once reached, like the residue on an empty bathtub. These products have found huge popularity among women of color who are thrilled to have moisturizers that don’t leave them looking chalky or too shiny and protect them from the sun’s rays.

   CHALKY Definition & Meaning | Dictionary.com

   www.dictionary.com/browse/chalky

   See all results for this question

3. www.dictionary.com › browse › chalkyCHALKY Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › chalky

   • Cached

   Chalky means of or like chalk, or lacking in color, detail, or warmth. Learn the origin, usage, and synonyms of chalky from Dictionary.com.

   • Chalkstone

     Chalkstone definition: a chalklike concretion in the tissues...

   • Chalkrail

     Chalkrail definition: a troughlike molding or strip holding...

   • Challenged

     Challenged definition: a euphemism for disabled (usually...

   • Challah

     Challah definition: a loaf of rich white bread leavened with...

   • Chalk Stripe

     Chalk stripe definition: (on a fabric) a pattern of thin...

   • Chalk Up

     Chalk up definition: to score or register (something). See...

   • Chalk Talk

     Chalk talk definition: a talk or lecture in which the...

   • Milky

     Milky definition: of or like milk, especially in appearance...

4. www.merriam-webster.com › dictionary › chalkyChalky Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › chalky

   • Cached

   Learn the meaning of chalk as a noun and a verb, with examples of usage and etymology. Find out how to say chalk in different languages and play word games related to chalk.

5. www.collinsdictionary.com › english-word › chalkyCHALKY - Find out everything about this English word | Collins

   www.collinsdictionary.com › english-word › chalky

   • Cached

   All you need to know about "CHALKY" in one place: definitions, pronunciations, synonyms, grammar insights, collocations, examples, and translations.

6. www.oxfordlearnersdictionaries.com › definitionchalky adjective - Definition, pictures, pronunciation and ...

   www.oxfordlearnersdictionaries.com › definition

   • Cached

   Definition of chalky adjective in Oxford Advanced Learner's Dictionary. Meaning, pronunciation, picture, example sentences, grammar, usage notes, synonyms and more.

7. www.oed.com › dictionary › chalky_adjchalky, adj. meanings, etymology and more | Oxford English ...

   www.oed.com › dictionary › chalky_adj

   • Cached

   What does the adjective chalky mean? There are three meanings listed in OED's entry for the adjective chalky. See ‘Meaning & use’ for definitions, usage, and quotation evidence. chalky has developed meanings and uses in subjects including. geology (Middle English) pathology (late 1700s)

8. www.ldoceonline.com › dictionary › chalkychalky | meaning of chalky in Longman Dictionary of ...

   www.ldoceonline.com › dictionary › chalky

   • Cached

   From Longman Dictionary of Contemporary English Related topics: Tastes, Geology chalky chalk‧y / ˈtʃɔːki $ ˈtʃɒː-/ adjective CT HEG similar to chalk or containing chalk white chalky soil There were chalky bits in the bottom of the drink. — chalkiness noun [uncountable] Examples from the Corpus chalky • This medicine tastes chalky.

9. en.thefreedictionary.com › chalkyChalky - definition of chalky by The Free Dictionary

   en.thefreedictionary.com › chalky

   • Cached

   Define chalky. chalky synonyms, chalky pronunciation, chalky translation, English dictionary definition of chalky. n. 1. A soft compact calcite, CaCO3, with varying amounts of silica, quartz, feldspar, or other mineral impurities, generally gray-white or yellow-white and...